PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.239590.1
Common NameCsa_7G236280, LOC101211248
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family WRKY
Protein Properties Length: 288aa    MW: 32406.7 Da    PI: 8.2636
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.239590.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1048.3e-33157214259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +Dgy+WrKYGqK vk+s++prsYYrCts++C vkk+vers +dp+vv++tYeg+Hnh+
  Cucsa.239590.1 157 EDGYRWRKYGQKAVKNSPYPRSYYRCTSQKCVVKKRVERSYQDPSVVITTYEGQHNHH 214
                     8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.1E-34141216IPR003657WRKY domain
SuperFamilySSF1182904.32E-29149216IPR003657WRKY domain
PROSITE profilePS5081132.271151216IPR003657WRKY domain
SMARTSM007741.1E-37156215IPR003657WRKY domain
PfamPF031061.2E-25157214IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MSNDEGKNVY QQYDPFQYNQ LDMNRSIFHQ QAAAALDPGL MSFTNFFDTS SLEYNSLSKA  60
FDVSCCSSQV ISAVDDVSKK KASTTTPNSS VSSSSNEAVV EEDSVKSNKL EDIKGRCENK  120
DEEKSKKQNS NLSKKKEKRP REPRFAFLTK SEIDHLEDGY RWRKYGQKAV KNSPYPRSYY  180
RCTSQKCVVK KRVERSYQDP SVVITTYEGQ HNHHCPATLR GHSAGIMSSP FYASASASVT  240
AASSGPTLPQ ELFSHLLPTN NCQTDPAASM MYQNLSLQQH LQLPDHYX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-291492171078Probable WRKY transcription factor 4
2lex_A3e-291492171078Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00440DAPTransfer from AT4G18170Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818000.0LN681800.1 Cucumis melo genomic scaffold, anchoredscaffold00017.
GenBankLN7132550.0LN713255.1 Cucumis melo genomic chromosome, chr_1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004139887.10.0PREDICTED: probable WRKY transcription factor 71
SwissprotQ8VWJ23e-54WRK28_ARATH; Probable WRKY transcription factor 28
TrEMBLA0A0A0K3H80.0A0A0A0K3H8_CUCSA; Uncharacterized protein
STRINGVIT_12s0028g00270.t012e-92(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22313483
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29860.14e-46WRKY DNA-binding protein 71
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]